PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn008351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 183aa    MW: 20333 Da    PI: 7.5025
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn008351genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.6e-4125120499
      DUF260   4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCk+lrrkC ++C++apyfp e+p+kf  vhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el+++++
  Achn008351  25 ACKFLRRKCLPGCIFAPYFPPEEPQKFVSVHKIFGASNVSKLLNEIMPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVMRLQKELDATNA 120
                 9******************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.12321122IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4025119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSDTHLLRPT CRHVGAEQVH KLNFACKFLR RKCLPGCIFA PYFPPEEPQK FVSVHKIFGA  60
SNVSKLLNEI MPHQREDAVN SLAYEAEARM KDPVYGCVGA ISVLQRQVMR LQKELDATNA  120
DLMRFTNNDM PNSSFSMFPG QYGARIGQGA FDHNSGFFLP YASQWNNNHS GCSSEEGGDG  180
TI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273053.16e-78PREDICTED: LOB domain-containing protein 25
RefseqXP_010660868.16e-78PREDICTED: LOB domain-containing protein 25
SwissprotQ9FML42e-61LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLF6HUW26e-78F6HUW2_VITVI; Putative uncharacterized protein
STRINGVIT_14s0066g00680.t012e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-62LBD family protein